aint

Hi, I am working on Protein and DNA sequences. When you have a protein sequence it can be translated in to DNA sequence in many ways. A nice way to express this is using regular expression. I would like to create this long regular expression for a protein sequence, and …

Hi, Last year I posted a question about making graphical representations of sentences, and at the end I did it with matplotlib. Now I wanted to add some more features to it, but I am stuck. you can see the previous post from this [URL="http://www.daniweb.com/software-development/python/threads/282934"]link[/URL] Now, if we assign a …

Hi, I have some .py files that I modify and run. Today I used one of them, and had some output on IDLE python shell. Now I run another .py file, but in between I get the result from the previous code. I tracked it down in the second script, …

Actually I do not know much, but once I came across a python web framework called Bottle. I am not sure if this is what you are looking for, but you can just check it out. [URL="http://bottlepy.org/docs/dev/index.html"]link to bottle[/URL]

Hi, I have many files made by a software. I want to extract some data from those files, and when I open the file with textedit, I see that what i need is on the first line. i have many of these files, and when I run the script, it …

is it possible to use the variable list from a function? here is an example? is it possible to call alist with its last used content? [CODE] def example(a): alist=[] alist.append(a) print alist example(1) print alist [/CODE] thanks

When I write a code, I put time related codes in the beginning and at the end to see how many seconds it takes. Is it possible to write it as a module, and refer to it when i write a code just with a single line of code? [CODE]import …

I didn't understand exactly your aim, but python has a time module which tells you the current time, month day year and so on. [CODE]import time print time.strftime('%a%A%b%d%m%B')[/CODE] TueTuesdayJunJuneTue Jun 15 15:53:00 2010150610 there is a long list of things you can get by this module [url]http://docs.python.org/library/time.html?highlight=time#module-time[/url] hope it helps

I am working on the folowing code, which basically counts every letter in a given text. I want to store the numbers in letter names: A=1 B=3 and so on... I guess it stores the number underthe name 'letter', but not under the corresponding letter 'A'. It would be great …

Hi, What I want to do is, to take multiple sentences, and create a bar representing the sentence length, and under that bars for words, or string of interest. And this process will be iterated over a text, so I can get many graphs on top of each other representing …

hi, I am working on a text proccessing project, actually related to protein sequences. I want to list occurrences of a search term with the hit positions. I tried the following, but it only gives it for the first hit. [CODE] text = 'MSKSASPKEPEQLRKLFIGGLSFETTDESLRSAHFESSSYGSAGRRF' index = text.find('SA') print index [/CODE] …